PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016463824.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 197aa    MW: 22055.9 Da    PI: 8.1911
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016463824.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF711.1e-222471249
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    +i n    qvtfskRr+g++KKA+ELS LC+aevavi+ s+ gk+y +
  XP_016463824.1 24 KIANRNSLQVTFSKRRAGLFKKASELSALCGAEVAVIVESPAGKVYSF 71
                    68899999**************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.9E-311574IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.9081575IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.29E-261695IPR002100Transcription factor, MADS-box
CDDcd002652.73E-331691No hitNo description
PRINTSPR004049.1E-201737IPR002100Transcription factor, MADS-box
PfamPF003194.8E-252471IPR002100Transcription factor, MADS-box
PRINTSPR004049.1E-203752IPR002100Transcription factor, MADS-box
PRINTSPR004049.1E-205273IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MEKKNEEGEI KKKSKGRQKI RIEKIANRNS LQVTFSKRRA GLFKKASELS ALCGAEVAVI  60
VESPAGKVYS FGNPCVDSVI NRYETGGHED RFSAALRLQI EEESKKKYFE AMGNLDKEKA  120
VTVGGTNNWW EDLSLDNLGL QELEESMASM EVLKKNLLKR ADDLANSSDD LLIPNLHQFG  180
APPLHYYNYN LGGRSSN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009601728.11e-144PREDICTED: agamous-like MADS-box protein AGL62
RefseqXP_016463824.11e-144PREDICTED: agamous-like MADS-box protein AGL62
TrEMBLM1DJG17e-54M1DJG1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000900242e-53(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20424223
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.12e-31AGAMOUS-like 62